Antibodies

Jump to Filters
View as table Download
DBX2 Rabbit Polyclonal Antibody
TA320189

USD 430.00

5 Days

Rabbit Polyclonal DBX2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DBX2 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human DBX2.
DBX2 Rabbit Polyclonal Antibody
TA342391

USD 375.00

5 Days

Rabbit Polyclonal Anti-DBX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBX2 antibody: synthetic peptide directed towards the middle region of human DBX2. Synthetic peptide located within the following region: SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLT
DBX2 Rabbit Polyclonal Antibody
TA342392

USD 375.00

5 Days

Rabbit Polyclonal Anti-DBX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBX2 antibody: synthetic peptide directed towards the N terminal of human DBX2. Synthetic peptide located within the following region: ALLNLPAAPGFGNLGKSFLIENLLRVGGAPTPRLQPPAPHDPATALATAG