Antibodies

Jump to Filters
View as table Download
KCNH7 (N-term) Rabbit Polyclonal Antibody
AP52306PU-N

USD 450.00

2 Weeks

KCNH7 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 58~87 amino acids from the N-terminal region of human KCNH7
KCNH7 Rabbit Polyclonal Antibody
TA338722

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNH7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the middle region of human KCNH7. Synthetic peptide located within the following region: LEKSKLKSKESLSSGVHLNTASEDNLTSLLKQDSDLSLELHLRQRKTYVH
KCNH7 Rabbit Polyclonal Antibody
TA338765

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNH7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the N terminal of human KCNH7. Synthetic peptide located within the following region: PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV