Antibodies

View as table Download

Rabbit Polyclonal Anti-ABP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF

Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801)

Rabbit Polyclonal Anti-CNDP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA

Rabbit Polyclonal Anti-CNDP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CNDP1