Rabbit Polyclonal Anti-ANGPTL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANGPTL1 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGPTL1. Synthetic peptide located within the following region: PDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVNGIFWAEYRGGS |
Rabbit Polyclonal Anti-ANGPTL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANGPTL1 antibody is: synthetic peptide directed towards the N-terminal region of Human ANGPTL1. Synthetic peptide located within the following region: KINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDM |
Carrier-free (BSA/glycerol-free) ANGPTL1 mouse monoclonal antibody, clone OTI9E5 (formerly 9E5)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANGPTL1 mouse monoclonal antibody, clone OTI9A7 (formerly 9A7)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Anti-ANGPTL1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 143-491 amino acids of human angiopoietin-like 1 |
USD 420.00
4 Weeks
ANGPTL1 mouse monoclonal antibody, clone OTI9E5 (formerly 9E5)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANGPTL1 mouse monoclonal antibody, clone OTI9E5 (formerly 9E5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
ANGPTL1 mouse monoclonal antibody, clone OTI9E5 (formerly 9E5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
ANGPTL1 mouse monoclonal antibody, clone OTI9E5 (formerly 9E5)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
ANGPTL1 mouse monoclonal antibody, clone OTI9A7 (formerly 9A7)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANGPTL1 mouse monoclonal antibody, clone OTI9A7 (formerly 9A7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
ANGPTL1 mouse monoclonal antibody, clone OTI9A7 (formerly 9A7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
ANGPTL1 mouse monoclonal antibody, clone OTI9A7 (formerly 9A7)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
