Antibodies

Jump to Filters
View as table Download
CTRP7 (C1QTNF7) Rabbit Polyclonal Antibody
TA306240

USD 430.00

5 Days

Rabbit Polyclonal CTRP7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTRP7 antibody was raised against a 15 amino acid peptide from near the carboxy-terminus of human CTRP7.
CTRP7 (C1QTNF7) Rabbit Polyclonal Antibody
TA306241

USD 430.00

5 Days

Rabbit Polyclonal CTRP7 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTRP7 antibody was raised against a 15 amino acid peptide from near the amino terminus of human CTRP7.
CTRP7 (C1QTNF7) Rabbit Polyclonal Antibody
TA306282

USD 430.00

5 Days

Rabbit Polyclonal CTRP7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit anti-CTRP7 polyclonal antibody was raised against recombinant human CTRP7.
CTRP7 (C1QTNF7) Rabbit Polyclonal Antibody
TA340209

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1QTNF7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QTNF7 antibody: synthetic peptide directed towards the middle region of human C1QTNF7. Synthetic peptide located within the following region: SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI