DGCR6L (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 107-135 amino acids from the Central region of human DGCR6L |
DGCR6L (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 107-135 amino acids from the Central region of human DGCR6L |
Rabbit Polyclonal Anti-DGCR6L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGCR6L antibody: synthetic peptide directed towards the C terminal of human DGCR6L. Synthetic peptide located within the following region: QQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTT |