Antibodies

View as table Download

DGCR6L (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 107-135 amino acids from the Central region of human DGCR6L

Rabbit Polyclonal Anti-DGCR6L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGCR6L antibody: synthetic peptide directed towards the C terminal of human DGCR6L. Synthetic peptide located within the following region: QQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTT