Antibodies

View as table Download

Rabbit Polyclonal Anti-MED31 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MED31 antibody: synthetic peptide directed towards the N terminal of human MED31. Synthetic peptide located within the following region: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN

Rabbit Polyclonal Anti-MED31 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Med31 antibody is: synthetic peptide directed towards the C-terminal region of Rat Med31. Synthetic peptide located within the following region: YEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNTTAG