Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal NURR1 (NR4A2) Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This NURR1 (NR4A2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human NURR1 (NR4A2). |
Rabbit Polyclonal Nurr1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide comprising residues 513-526 [TERHGLKEPKRVEE] of the human Nurr1 protein. Based on 100% sequence homology, this antibody is also expected to cross react with rat and mouse Nurr1. |
Rabbit Polyclonal Anti-NR4A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A2 antibody: synthetic peptide directed towards the C terminal of human NR4A2. Synthetic peptide located within the following region: NGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLF |
Rabbit Polyclonal Anti-NR4A2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A2 antibody: synthetic peptide directed towards the N terminal of human NR4A2. Synthetic peptide located within the following region: MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTE |
Rabbit Polyclonal Anti-NR4A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A2 antibody: synthetic peptide directed towards the middle region of human NR4A2. Synthetic peptide located within the following region: FSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYL |
