Rabbit Polyclonal Anti-SSBP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SSBP3 Antibody: synthetic peptide directed towards the middle region of human SSBP3. Synthetic peptide located within the following region: SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP |
Rabbit Polyclonal Anti-SSBP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SSBP3 Antibody: synthetic peptide directed towards the middle region of human SSBP3. Synthetic peptide located within the following region: DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV |
Germany
Japan
United Kingdom
China