Goat Polyclonal Antibody against TUSC3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PQRQCSVCRQAN, from the internal region of the protein sequence according to NP_006756.2; NP_839952.1. |
Goat Polyclonal Antibody against TUSC3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PQRQCSVCRQAN, from the internal region of the protein sequence according to NP_006756.2; NP_839952.1. |
Rabbit polyclonal anti-B4GALT3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALT3. |
Rabbit Polyclonal Anti-TUSC3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUSC3 Antibody: A synthesized peptide derived from human TUSC3 |
Goat Anti-MGAT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QVEKVRTNDR, from the internal region of the protein sequence according to NP_002397.2. |
Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697) |
Rabbit polyclonal anti-TUSC3 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TUSC3. |
Rabbit Polyclonal Anti-Alg8 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Alg8 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI6F2 (formerly 6F2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN2 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DDOST mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DDOST mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DDOST mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) DDOST mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ALG12 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 367-488 amino acids of human ALG12, alpha-1,6-mannosyltransferase |
Anti-ALG12 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 367-488 amino acids of human ALG12, alpha-1,6-mannosyltransferase |
Anti-ALG9 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 427-611 amino acids of human ALG9, alpha-1,2-mannosyltransferase |
Anti-ALG9 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 427-611 amino acids of human ALG9, alpha-1,2-mannosyltransferase |
Anti-ALG8 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 25-122 amino acids of human ALG8, alpha-1,3-glucosyltransferase |
Rabbit Polyclonal Anti-RPN1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RPN1 |
Rabbit Polyclonal Anti-ALG6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALG6 |
Rabbit Polyclonal Anti-FUT8 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FUT8 |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6F2 (formerly 6F2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6F2 (formerly 6F2), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6F2 (formerly 6F2), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6F2 (formerly 6F2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
RPN1 mouse monoclonal antibody,clone 5A1, Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
RPN1 mouse monoclonal antibody,clone 5A1, HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
RPN1 mouse monoclonal antibody,clone 6A9, Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
RPN1 mouse monoclonal antibody,clone 6A9, HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | HRP |