Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 95 results

Page 1 of 2

(reset)

TUSC3 Goat Polyclonal Antibody

TA303338

USD 375.00

In Stock

Goat Polyclonal Antibody against TUSC3

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence PQRQCSVCRQAN, from the internal region of the protein sequence according to NP_006756.2; NP_839952.1.

B4GALT3 Rabbit Polyclonal Antibody

TA314795

USD 345.00

In Stock

Rabbit polyclonal anti-B4GALT3 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human B4GALT3.

1 / 2

2 / 2

Previous Next

TUSC3 Rabbit Polyclonal Antibody

TA347683

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TUSC3 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TUSC3 Antibody: A synthesized peptide derived from human TUSC3

MGAT1 Goat Polyclonal Antibody

TA311230

USD 375.00

2 Weeks

Goat Anti-MGAT1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-QVEKVRTNDR, from the internal region of the protein sequence according to NP_002397.2.

alpha Glucosidase II (GANAB) Rabbit Polyclonal Antibody

TA308533

USD 415.00

5 Days

Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697)

1 / 2

2 / 2

Previous Next

TUSC3 Rabbit Polyclonal Antibody

TA312791

USD 345.00

4 Weeks

Rabbit polyclonal anti-TUSC3 antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human TUSC3.

1 / 2

2 / 2

Previous Next

ALG8 Rabbit Polyclonal Antibody

TA335475

USD 375.00

5 Days

Rabbit Polyclonal Anti-Alg8 Antibody

Applications	WB
Reactivities	Rat
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-Alg8 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI6F2]

CF503647

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI6F2 (formerly 6F2)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]

CF503648

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

CF503649

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI5A1]

CF503650

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI6A9]

CF503651

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI1G5]

CF503652

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI2G9]

CF503653

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI2G1]

CF503654

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI5B1]

CF503655

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI2E3]

CF503666

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Ribophorin II (RPN2) Mouse Monoclonal Antibody [Clone ID: OTI1G9]

CF504604

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RPN2 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

DDOST Mouse Monoclonal Antibody [Clone ID: OTI1C1]

CF803614

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DDOST mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

DDOST Mouse Monoclonal Antibody [Clone ID: OTI2H2]

CF803618

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DDOST mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

DDOST Mouse Monoclonal Antibody [Clone ID: OTI2H1]

CF803619

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DDOST mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

DDOST Mouse Monoclonal Antibody [Clone ID: OTI2B4]

CF803634

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) DDOST mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

B4GALT3 Mouse Monoclonal Antibody [Clone ID: OTI1G9]

CF808622

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

ALG12 Rabbit Polyclonal Antibody

TA322185

USD 345.00

In Stock

Anti-ALG12 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 367-488 amino acids of human ALG12, alpha-1,6-mannosyltransferase

ALG12 Rabbit Polyclonal Antibody

TA322186

USD 345.00

In Stock

Anti-ALG12 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 367-488 amino acids of human ALG12, alpha-1,6-mannosyltransferase

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALG9 Rabbit Polyclonal Antibody

TA323315

USD 345.00

In Stock

Anti-ALG9 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 427-611 amino acids of human ALG9, alpha-1,2-mannosyltransferase

ALG9 Rabbit Polyclonal Antibody

TA323316

USD 345.00

In Stock

Anti-ALG9 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 427-611 amino acids of human ALG9, alpha-1,2-mannosyltransferase

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALG8 Rabbit Polyclonal Antibody

TA323479

USD 345.00

In Stock

Anti-ALG8 Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 25-122 amino acids of human ALG8, alpha-1,3-glucosyltransferase

Ribophorin I (RPN1) Rabbit Polyclonal Antibody

TA349562

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-RPN1 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human RPN1

ALG6 Rabbit Polyclonal Antibody

TA350848

USD 345.00

In Stock

Rabbit Polyclonal Anti-ALG6 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human ALG6

FUT8 Rabbit Polyclonal Antibody

TA351201

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-FUT8 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human FUT8

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI6F2]

TA503647

USD 379.00

In Stock

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6F2 (formerly 6F2)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6F2]

TA503647AM

USD 420.00

4 Weeks

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6F2 (formerly 6F2), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F2]

TA503647BM

USD 420.00

4 Weeks

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6F2 (formerly 6F2), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI6F2]

TA503647S

USD 159.00

2 Days

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6F2 (formerly 6F2)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]

TA503648

USD 379.00

In Stock

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H3]

TA503648AM

USD 420.00

4 Weeks

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H3]

TA503648BM

USD 420.00

4 Weeks

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]

TA503648S

USD 159.00

2 Days

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

TA503649

USD 379.00

In Stock

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]

TA503649AM

USD 420.00

4 Weeks

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E1]

TA503649BM

USD 420.00

4 Weeks

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

TA503649S

USD 159.00

In Stock

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI5A1]

TA503650

USD 379.00

In Stock

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A1]

TA503650AM

USD 420.00

5 Days

RPN1 mouse monoclonal antibody,clone 5A1, Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A1]

TA503650BM

USD 420.00

5 Days

RPN1 mouse monoclonal antibody,clone 5A1, HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI5A1]

TA503650S

USD 159.00

2 Days

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody [Clone ID: OTI6A9]

TA503651

USD 379.00

In Stock

RPN1 (Ribophorin I) mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A9]

TA503651AM

USD 420.00

5 Days

RPN1 mouse monoclonal antibody,clone 6A9, Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Ribophorin I (RPN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A9]

TA503651BM

USD 420.00

5 Days

RPN1 mouse monoclonal antibody,clone 6A9, HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

1 - 50 of 95 results

Page 1 of 2