Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-BMP10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human BMP10. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Bmp10 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bmp10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV |
Rabbit Polyclonal Anti-BMP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BMP10 antibody is: synthetic peptide directed towards the C-terminal region of Human BMP10. Synthetic peptide located within the following region: GYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLE |
