Antibodies

Jump to Filters
View as table Download
KCNJ8 (N-term) Rabbit Polyclonal Antibody
AP52312PU-N

USD 450.00

2 Weeks

KCNJ8 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 4-33 amino acids from the N-terminal region of human KCNJ8
KCNJ8 Rabbit Polyclonal Antibody
TA338551

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNJ8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ8 antibody: synthetic peptide directed towards the middle region of human KCNJ8. Synthetic peptide located within the following region: EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK