Rabbit Polyclonal Anti-SLC11A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC11A1 Antibody: synthetic peptide directed towards the C terminal of human SLC11A1. Synthetic peptide located within the following region: VLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT |
Rabbit polyclonal SLC11A1 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-276 amino acids from the Central region of human SLC11A1. |
Rabbit Polyclonal Anti-SLC11A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC11A1 Antibody is: synthetic peptide directed towards the middle region of Human SLC11A1. Synthetic peptide located within the following region: GYEYVVARPEQGALLRGLFLPSCPGCGHPELLQAVGIVGAIIMPHNIYLH |
Germany
Japan
United Kingdom
China