Antibodies

Jump to Filters
View as table Download
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA345768

USD 410.00

5 Days

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA590463

USD 409.00

In Stock

Rabbit Polyclonal Placental Lactogen Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA350056

USD 345.00

In Stock

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CSH1