Rabbit Polyclonal Anti-ACTR1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTR1B antibody: synthetic peptide directed towards the C terminal of human ACTR1B. Synthetic peptide located within the following region: KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF |
Goat Polyclonal Antibody against ACTR1B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YEEDGSRAIHRKT, from the C Terminus of the protein sequence according to NP_005726. |
Rabbit anti-ACTR1B polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit Polyclonal Anti-ACTR1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTR1B antibody: synthetic peptide directed towards the middle region of human ACTR1B. Synthetic peptide located within the following region: VGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL |
ACTR1B Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human ACTR1B (NP_005726.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
