CSNK1G1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CSNK1G1 |
CSNK1G1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CSNK1G1 |
Rabbit polyclonal anti-CKI-?1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CKI-?1. |
Rabbit polyclonal anti-Csnk1g1 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Csnk1g1 antibody: synthetic peptide directed towards the middle region of mouse Csnk1g1. Synthetic peptide located within the following region: FDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEV |
Rabbit polyclonal anti-CSNK1G1 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSNK1G1 antibody: synthetic peptide directed towards the middle region of mouse CSNK1G1. Synthetic peptide located within the following region: CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW |
CSNK1G1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 298-422 of human CSNK1G1 (NP_071331.2). |
Modifications | Unmodified |
CSNK1G1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 298-422 of human CSNK1G1 (NP_071331.2). |
Modifications | Unmodified |