Rabbit Polyclonal Anti-FAM222A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM222A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM222A. Synthetic peptide located within the following region: PQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSVLKSAEGKRTKLSPAAVQ |
Rabbit Polyclonal Anti-FAM222A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM222A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM222A. Synthetic peptide located within the following region: SRTVNGYDTSGQRYSPYPQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSV |
Germany
Japan
United Kingdom
China