Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-GPR173 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR173. |
Antibodies
View as table Download
Rabbit polyclonal anti-GPR173 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR173. |
Rabbit Polyclonal Anti-GPR173 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR173 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR173. Synthetic peptide located within the following region: IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV |
GPR173 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human GPR173 (NP_061842.1). |
| Modifications | Unmodified |