Antibodies

Jump to Filters
View as table Download
Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody
TA346086

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
Gpx3 Goat Polyclonal Antibody
TA303205

USD 375.00

5 Days

Goat Polyclonal Antibody against GPX3

Applications IHC, WB
Reactivities Mouse, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-NQFGKQEPGENSE, from the internal region of the protein sequence according to NP_002075.2.
Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody
TA376760

USD 220.00

3 Weeks

GPX3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GPX3.
Modifications Unmodified