Rabbit Polyclonal Anti-MYNN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYNN Antibody: synthetic peptide directed towards the middle region of human MYNN. Synthetic peptide located within the following region: KSPYEAENSGEELDQRYSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPY |
Rabbit Polyclonal Anti-MYNN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYNN Antibody: synthetic peptide directed towards the middle region of human MYNN. Synthetic peptide located within the following region: CQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRC |
MYNN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human MYNN (NP_061127.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China