Rabbit Polyclonal Anti-NELF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NELF antibody: synthetic peptide directed towards the N terminal of human NELF. Synthetic peptide located within the following region: GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADA |
Rabbit Polyclonal Anti-NELF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NELF antibody: synthetic peptide directed towards the middle region of human NELF. Synthetic peptide located within the following region: RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG |
NSMF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 226-505 of human NSMF (NP_001124443.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
