Antibodies

View as table Download

Rabbit polyclonal anti-PXMP3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human PXMP3.

Rabbit Polyclonal anti-Pxmp3 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pxmp3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVK

PEX2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEX2 (NP_001165558.1).
Modifications Unmodified