Rabbit Polyclonal antibody to Protease Inhibitor 15 (peptidase inhibitor 15)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 195 and 258 of Protease Inhibitor 15 (Uniprot ID#O43692) |
Rabbit Polyclonal Anti-PI15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI15 antibody: synthetic peptide directed towards the N terminal of human PI15. Synthetic peptide located within the following region: PPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKV |
PI15 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 61-170 of human PI15 (NP_056970.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
