Antibodies

View as table Download

Rabbit Polyclonal Anti-RMND5B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RMND5B Antibody is: synthetic peptide directed towards the N-terminal region of Human RMND5B. Synthetic peptide located within the following region: ELDKVLQKFLTYGQHCERSLEELLHYVGQLRAELASAALQGTPLSATLSL

RMND5B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RMND5B

RMND5B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RMND5B