SLC29A2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC29A2 |
SLC29A2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC29A2 |
Rabbit Polyclonal Anti-SLC29A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SLC29A2 antibody was raised against a 19 amino acid peptide near the center of human SLC29A2. |
Rabbit Polyclonal Anti-SLC29A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC29A2 Antibody: synthetic peptide directed towards the N terminal of human SLC29A2. Synthetic peptide located within the following region: ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL |
Rabbit Polyclonal Anti-SLC29A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC29A2 Antibody: synthetic peptide directed towards the C terminal of human SLC29A2. Synthetic peptide located within the following region: PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV |
SLC29A2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC29A2 |
ENT2 Rabbit monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |