SOX11 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SOX11 |
SOX11 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SOX11 |
Rabbit Polyclonal Anti-SOX11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the N terminal of human SOX11. Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK |
Rabbit Polyclonal Anti-SOX11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the middle region of human SOX11. Synthetic peptide located within the following region: PHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAG |
Rabbit Polyclonal Anti-SOX11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the N terminal of human SOX11. Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK |
Rabbit Polyclonal Anti-SOX11 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SOX11 |
SOX11 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human SOX11. |
Modifications | Unmodified |
SOX11 rabbit monoclonal antibody, clone OTIR3D12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SOX11 rabbit monoclonal antibody, clone OTIR3D12
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |