Antibodies

View as table Download

Rabbit polyclonal Anti-SULT1C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SULT1C2 antibody: synthetic peptide directed towards the C terminal of human SULT1C2. Synthetic peptide located within the following region: LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL

SULT1C2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SULT1C2 (NP_001047.1).
Modifications Unmodified