Antibodies

View as table Download

Rabbit Polyclonal TLR6 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TLR6 antibody was raised against a peptide corresponding to 13 amino acids near the center of human TLR6.

Rabbit Polyclonal TLR6 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR6 antibody was raised against a peptide corresponding to 15 amino acids near the amino terminus of human TLR6.

Rabbit Polyclonal anti-TLR6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR6 antibody: synthetic peptide directed towards the middle region of human TLR6. Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT

Rabbit Polyclonal Anti-TLR6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR6

Rabbit Polyclonal Anti-TLR6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TLR6

TLR6 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR6

TLR6 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 32-200 of human TLR6 (NP_006059.2).
Modifications Unmodified

Toll-Like Receptor 6 Rabbit polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of TLR6