Rabbit Polyclonal TLR6 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TLR6 antibody was raised against a peptide corresponding to 13 amino acids near the center of human TLR6. |
Rabbit Polyclonal TLR6 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TLR6 antibody was raised against a peptide corresponding to 13 amino acids near the center of human TLR6. |
Rabbit Polyclonal TLR6 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TLR6 antibody was raised against a peptide corresponding to 15 amino acids near the amino terminus of human TLR6. |
Rabbit Polyclonal anti-TLR6 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TLR6 antibody: synthetic peptide directed towards the middle region of human TLR6. Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT |
Rabbit Polyclonal Anti-TLR6 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLR6 |
Rabbit Polyclonal Anti-TLR6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TLR6 |
TLR6 rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLR6 |
TLR6 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 32-200 of human TLR6 (NP_006059.2). |
Modifications | Unmodified |
Toll-Like Receptor 6 Rabbit polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of TLR6 |