Antibodies

View as table Download

Rabbit Polyclonal Anti-TNFSF14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM

Goat Anti-LIGHT / CD258 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HEVNPAAHLTGANS, from the internal region of the protein sequence according to NP_003798.2; NP_742011.1.

Rabbit polyclonal anti-TNF14 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNF14

TNFSF14/LIGHT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFSF14/LIGHT
Modifications Unmodified