Antibodies

Jump to Filters
View as table Download
RHOD Rabbit Polyclonal Antibody
TA312722

USD 345.00

4 Weeks

Rabbit polyclonal anti-RHOD antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RHOD.
RHOD Rabbit Polyclonal Antibody
TA344099

USD 475.00

5 Days

Rabbit Polyclonal Anti-RHOD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOD antibody: synthetic peptide directed towards the N terminal of human RHOD. Synthetic peptide located within the following region: TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF
RHOD Rabbit Polyclonal Antibody
TA344100

USD 475.00

5 Days

Rabbit Polyclonal Anti-RHOD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOD antibody: synthetic peptide directed towards the C terminal of human RHOD. Synthetic peptide located within the following region: NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG
RHOD Mouse Monoclonal Antibody [Clone ID: OTI2F7]
CF503891

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RHOD mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
RHOD Mouse Monoclonal Antibody [Clone ID: OTI2F7]
TA503891

USD 379.00

In Stock

RHOD mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
RHOD Mouse Monoclonal Antibody [Clone ID: OTI2F7]
TA503891S

USD 159.00

2 Days

RHOD mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated