Antibodies

View as table Download

Syndecan 3 (SDC3) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 411-442 amino acids from the C-terminal region of Human SDC3

Rabbit Polyclonal Anti-Sdc3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sdc3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL

Rabbit Polyclonal Anti-SDC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SDC3 antibody is: synthetic peptide directed towards the C-terminal region of Human SDC3. Synthetic peptide located within the following region: VGGVVGALFAAFLVTLLIYRMKKKDEGSYTLEEPKQASVTYQKPDKQEEF