Mouse monoclonal Contactin/F3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse monoclonal Contactin/F3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Anti-contactin 1 (aa585-870) Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QVTSQEYSARLEN, from the internal region of the protein sequence according to NP_001834.2; NP_778203.1. |
Contactin 1 (CNTN1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 641~671 amino acids from the Central region of human CNTN1 |
Goat Anti-contactin 1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ENIRGKDKHQAR, from the internal region of the protein sequence according to NP_001834.2; NP_778203.1; NP_001242992.1. |
Rabbit Polyclonal Anti-CNTN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the middle region of human CNTN1. Synthetic peptide located within the following region: QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW |
Rabbit Polyclonal Anti-CNTN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the N terminal of human CNTN1. Synthetic peptide located within the following region: NGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATL |