Rabbit Polyclonal Anti-DAK Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DAK Antibody: A synthesized peptide derived from human DAK |
Rabbit Polyclonal Anti-DAK Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DAK Antibody: A synthesized peptide derived from human DAK |
Rabbit polyclonal anti-DAK antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DAK. |
Rabbit Polyclonal Anti-DAK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DAK Antibody: synthetic peptide directed towards the N terminal of human DAK. Synthetic peptide located within the following region: MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA |