Rabbit polyclonal anti-RPS21 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS21. |
Rabbit polyclonal anti-RPS21 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS21. |
Rabbit polyclonal RPS21 Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This RPS21 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 44-71 amino acids from the C-terminal region of human RPS21. |
Rabbit Polyclonal Anti-RPS21 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RPS21 Antibody: synthetic peptide directed towards the N terminal of human RPS21. Synthetic peptide located within the following region: MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF |
Rabbit Polyclonal Anti-RPS21 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RPS21 Antibody: synthetic peptide directed towards the middle region of human RPS21. Synthetic peptide located within the following region: NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF |