Antibodies

Jump to Filters
View as table Download
EFTUD2 Rabbit Polyclonal Antibody
TA335754

USD 375.00

5 Days

Rabbit Polyclonal Anti-EFTUD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EFTUD2 Antibody is: synthetic peptide directed towards the middle region of Human EFTUD2. Synthetic peptide located within the following region: ADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPL