Antibodies

Jump to Filters
View as table Download
SFRS3 (SRSF3) Rabbit Polyclonal Antibody
TA345823

USD 475.00

5 Days

Rabbit Polyclonal Anti-SFRS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS3 antibody: synthetic peptide directed towards the N terminal of human SFRS3. Synthetic peptide located within the following region: SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS
SFRS3 (SRSF3) Rabbit Polyclonal Antibody
TA314521

USD 345.00

4 Weeks

Rabbit polyclonal anti-SFRS3 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SFRS3.