Antibodies

View as table Download

Rabbit Polyclonal Anti-SFRS9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS9 antibody: synthetic peptide directed towards the middle region of human SFRS9. Synthetic peptide located within the following region: VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER

Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated