Antibodies

Jump to Filters
View as table Download
UBE2D4 Rabbit Polyclonal Antibody
TA330654

USD 375.00

5 Days

Rabbit Polyclonal Anti-UBE2D4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-UBE2D4 antibody is: synthetic peptide directed towards the C-terminal region of Human UBE2D4. Synthetic peptide located within the following region: ALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKY
UBE2D4 Mouse Monoclonal Antibody [Clone ID: OTI1B1]
CF810786

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2D4 mouse monoclonal antibody,clone OTI1B1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
UBE2D4 Mouse Monoclonal Antibody [Clone ID: OTI1B1]
TA810786

USD 379.00

In Stock

UBE2D4 mouse monoclonal antibody,clone OTI1B1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated