Rabbit Polyclonal UBCH6 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human UBCH6 protein (between residues 1-50) [UniProt P51965] |
Rabbit Polyclonal UBCH6 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human UBCH6 protein (between residues 1-50) [UniProt P51965] |
Rabbit Polyclonal anti-Ube2h Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Ube2h antibody is: synthetic peptide directed towards the C-terminal region of Rat Ube2h. Synthetic peptide located within the following region: FESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL |
UBE2E1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBE2E1 |
UBE2E1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |