Antibodies

View as table Download

Rabbit polyclonal antibody to CENTG2 (centaurin, gamma 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 795 and 857 of AGAP1 (Uniprot ID#Q9UPQ3)

Rabbit Polyclonal Anti-AGAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGAP1 antibody is: synthetic peptide directed towards the middle region of Human AGAP1. Synthetic peptide located within the following region: NTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQG

Carrier-free (BSA/glycerol-free) AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-AGAP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 101-114 amino acids of human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1

AGAP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AGAP1

AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AGAP1 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated