Antibodies

View as table Download

Rabbit Polyclonal Anti-CLEC4M Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the N terminal of human CLEC4M. Synthetic peptide located within the following region: LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV

Rabbit Polyclonal Anti-CLEC4M Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the n terminal of human CLEC4M. Synthetic peptide located within the following region: MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA

Rabbit Polyclonal Anti-CLEC4M Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the middle region of human CLEC4M. Synthetic peptide located within the following region: NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS

Rabbit Polyclonal anti-CLEC4M antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the middle region of human CLEC4M. Synthetic peptide located within the following region: CYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWM

Carrier-free (BSA/glycerol-free) CLEC4M mouse monoclonal antibody,clone OTI10C3

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CLEC4M mouse monoclonal antibody,clone OTI7D12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CLEC4M rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLEC4M

CLEC4M Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 280-399 of human CLEC4M (NP_055072.3).
Modifications Unmodified

Recombinant Anti-DC-SIGNR (Clone 16E7)

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-DC-SIGNR (Clone 16E7)

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques.

CLEC4M mouse monoclonal antibody,clone OTI10C3

Applications IHC
Reactivities Human
Conjugation Unconjugated