Antibodies

View as table Download

Rabbit Polyclonal Anti-MED6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED6 antibody is: synthetic peptide directed towards the N-terminal region of Human MED6. Synthetic peptide located within the following region: ILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLH

Rabbit Polyclonal Anti-MED6 Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: ALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKN

Rabbit Polyclonal Anti-MED6 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV

Rabbit Polyclonal Anti-MED6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED6 antibody is: synthetic peptide directed towards the C-terminal region of Human MED6. Synthetic peptide located within the following region: KPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRL

MED6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 134-164 amino acids from the Central region of human MED6

MED6 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 214-246 amino acids from the C-terminal region of human MED6

Carrier-free (BSA/glycerol-free) MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MED6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

MED6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

MED6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-246 of human MED6 (NP_005457.2).
Modifications Unmodified

MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MED6 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MED6 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated