Antibodies

Jump to Filters
View as table Download
OR4A47 Rabbit Polyclonal Antibody
TA312150

USD 345.00

4 Weeks

Rabbit polyclonal OR4A4/4A47 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4A4/4A47.
OR4A47 (C-term) Rabbit Polyclonal Antibody
AP53047PU-N

USD 450.00

2 Weeks

OR4A47 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 205-233 amino acids from the C-terminal region of Human Olfactory receptor 4A47
OR4A47 Rabbit Polyclonal Antibody
TA337501

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR4A47 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR4A47 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4A47. Synthetic peptide located within the following region: ACTIVFLLLLISYGVILHSLKNLSQKGRQKALSTCSSHMTVVVFFFVPCI