SMARCA1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMARCA1 |
SMARCA1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMARCA1 |
Rabbit Polyclonal Anti-SMARCA1 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SMARCA1 Antibody: synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: EQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATE |
Rabbit Polyclonal Anti-SMARCA1 Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMARCA1 antibody: synthetic peptide directed towards the N terminal of mouse SMARCA1. Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS |
Rabbit Polyclonal Anti-SMARCA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SMARCA1 Antibody: synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: QEEGAAAAATEATAATEKGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYE |
Rabbit Polyclonal Anti-SMARCA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: EQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATE |
Rabbit polyclonal anti-SNF2L antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SNF2L |
SMARCA1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SMCA1 |
SMARCA1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMARCA1 |
SMARCA1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SMARCA1 (NP_003060.2). |
Modifications | Unmodified |