Antibodies

View as table Download

CASS4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CASS4

Rabbit Polyclonal Anti-CASS4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CASS4 antibody is: synthetic peptide directed towards the N-terminal region of Human CASS4. Synthetic peptide located within the following region: ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL

CASS4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CASS4