Antibodies

View as table Download

Rabbit Polyclonal Anti-FBP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBP2 antibody: synthetic peptide directed towards the middle region of human FBP2. Synthetic peptide located within the following region: YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ

Rabbit Polyclonal Anti-FBP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBP2 antibody: synthetic peptide directed towards the middle region of human FBP2. Synthetic peptide located within the following region: YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY

Rabbit Polyclonal Anti-FBP2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FBP2

FBP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FBP2

FBP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-339 of human FBP2 (NP_003828.2).
Modifications Unmodified