Antibodies

View as table Download

Rabbit Polyclonal Anti-KCTD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD10 antibody: synthetic peptide directed towards the N terminal of human KCTD10. Synthetic peptide located within the following region: MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL

Rabbit Polyclonal Anti-KCTD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD10 antibody: synthetic peptide directed towards the middle region of human KCTD10. Synthetic peptide located within the following region: EETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERIERVRRI

KCTD10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human KCTD10 (NP_114160.1).
Modifications Unmodified