Rabbit Polyclonal Anti-NR6A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR6A1 antibody: synthetic peptide directed towards the N terminal of human NR6A1. Synthetic peptide located within the following region: FCQDELAELDPGTISVSDDRAEQRTCLICGDRATGLHYGIISCEGCKGFF |
Carrier-free (BSA/glycerol-free) NR6A1 mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NR6A1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human NR6A1 |
NR6A1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NR6A1 |
NR6A1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NR6A1 |
NR6A1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NR6A1 |
NR6A1 mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR6A1 mouse monoclonal antibody,clone OTI6F3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NR6A1 mouse monoclonal antibody,clone OTI6F3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NR6A1 mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China