Antibodies

Jump to Filters
View as table Download
Sphingomyelin Synthase 1 (SGMS1) Rabbit Polyclonal Antibody
TA329765

USD 375.00

5 Days

Rabbit polyclonal Anti-SGMS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGMS1 antibody: synthetic peptide directed towards the middle region of human SGMS1. Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI
Sphingomyelin Synthase 1 (SGMS1) Rabbit Polyclonal Antibody
TA381448

USD 220.00

3 Weeks

SGMS1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human SGMS1 (NP_671512.1).
Modifications Unmodified