Antibodies

View as table Download

Rabbit polyclonal anti-TLE2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TLE2.

Rabbit Polyclonal Anti-TLE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLE2 antibody: synthetic peptide directed towards the N terminal of human TLE2. Synthetic peptide located within the following region: VEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSP

Carrier-free (BSA/glycerol-free) TLE2 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TLE2 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TLE2 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

TLE2 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TLE2 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated